PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma68g00080.1
Common NameZOSMA_68G00080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MYB
Protein Properties Length: 370aa    MW: 42013.3 Da    PI: 7.3621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma68g00080.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-1673120148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEde+l++ + ++G g+W+t+++  g+ R++k+c++rw++yl
  Zosma68g00080.1  73 KGLWSPEEDEKLYNHIIRYGVGCWSTVPQQAGLQRCGKSCRLRWLNYL 120
                      678*******************************************97 PP

2Myb_DNA-binding48.42.2e-15126170147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++e+++l++ +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Zosma68g00080.1 126 RGTFSQEDEDLIISLHQVLGNK-WSQIASHLQ-GRTDNEIKNFWNST 170
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-2565123IPR009057Homeodomain-like
PROSITE profilePS5129417.30968120IPR017930Myb domain
SuperFamilySSF466891.24E-2870167IPR009057Homeodomain-like
SMARTSM007171.6E-1272122IPR001005SANT/Myb domain
PfamPF002491.5E-1473120IPR001005SANT/Myb domain
CDDcd001675.59E-1176120No hitNo description
PROSITE profilePS5129424.905121175IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-25124175IPR009057Homeodomain-like
SMARTSM007177.7E-15125173IPR001005SANT/Myb domain
PfamPF002494.4E-14126170IPR001005SANT/Myb domain
CDDcd001673.22E-10128171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MHINKLEQEV LHIYKTSLPF LNRHRSCSAV VLDPHPPLRR HALTYVPILT TLLALLNLVM  60
GRHPSCLKQK LKKGLWSPEE DEKLYNHIIR YGVGCWSTVP QQAGLQRCGK SCRLRWLNYL  120
RPDLKRGTFS QEDEDLIISL HQVLGNKWSQ IASHLQGRTD NEIKNFWNST LKKKLRSQGI  180
DPNTHRPLAD NNMELLQKTQ CPHTPNKLSP APATRPPLFD PFPSSHNIIQ KTEPHCPDFI  240
LTPDVEYDST PNSNFAPYDI VLDVWNCYNN NNNNNTIIDS KSSIISSNGD TLSNSSNRKS  300
MSSSAQICNH NNNSSFNWVV QQDNKLDSSL QNFHLEDTTS FEDYGAFPQI PFPVGFDCGF  360
DDAYSCLDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27711755108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170176LKKKLRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936645.13e-80PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0K9NTN00.0A0A0K9NTN0_Z
STRINGBRADI2G47590.13e-75(Brachypodium distachyon)
STRINGSi022730m8e-75(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-72myb domain protein 86